PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 333aa    MW: 38127.9 Da    PI: 4.791
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919159.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.49.3e-5681371129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv +yLkkkv+++k++l +vi+++d+y++ePwdL++  ++   e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v
  XP_010919159.1   8 VPPGFRFHPTDEELVGYYLKKKVASQKIDL-DVIRDIDLYRIEPWDLQErcRIGYeEQSEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAV 101
                     69****************************.9***************953433332566************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  XP_010919159.1 102 HD-KNKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 137
                     **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-606157IPR003441NAC domain
PROSITE profilePS5100559.3878157IPR003441NAC domain
PfamPF023653.6E-299136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MDSMESCVPP GFRFHPTDEE LVGYYLKKKV ASQKIDLDVI RDIDLYRIEP WDLQERCRIG  60
YEEQSEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKA VHDKNKLIGM RKTLVFYKGR  120
APNGQKTDWI MHEYRLESEE NGPPQEEGWV VCRAFKKRTA CPTRSVVDVW DSNYGYDEPS  180
RASSSFVDPI EYLQSQPKSL LCKQETELDP LNLLHSNQFL QLPQLESPSL PLVKPPSLLS  240
IPTENELDEE RTRGCNAIEK VTDWRALDKF VASQLSQEDG FSAERVGSDF GLDDDSDMAL  300
LLLQSGREEV GKLNGFLTTG GPECDVGIFV FEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50515912170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919159.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9SL411e-145NAC37_ARATH; NAC domain-containing protein 37
TrEMBLF6GWP20.0F6GWP2_VITVI; Putative uncharacterized protein
STRINGVIT_04s0023g03110.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-128vascular related NAC-domain protein 1